Structure of PDB 4gv9 Chain A Binding Site BS02

Receptor Information

>4gv9 Chain A (length=198) Species: 11622 (Lassa virus Josiah) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

FGLTYSQLMTLKDAMLQLDPNAKTWMDIEGRPEDPVEIALYQPSSGCYIH
FFREPTDLKQFKQDAKYSHGIDVTDLFATQPGLTSAVIDALPRNMVITCQ
GSDDIRKLLESQGRKDIKLIDIALSKTDSRKYENAVWDQYKDLCHMHTGV
VVEKEEITPHCALMDCIMFDAAVSGGLNTSVLRAVLPRDMVFRPRVVL

Ligand information

>4gv9 Chain F (length=5) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

cgccc

.....

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4gv9 Structures of Arenaviral Nucleoproteins with Triphosphate dsRNA Reveal a Unique Mechanism of Immune Suppression.
Resolution	2.46 Å
Binding residue (original residue number in PDB)	R393 Y429
Binding residue (residue number reindexed from 1)	R31 Y67

Enzymatic activity

Enzyme Commision number

3.1.13.-

External links

PDB	RCSB:4gv9, PDBe:4gv9, PDBj:4gv9
PDBsum	4gv9
PubMed	23615902
UniProt	P13699\|NCAP_LASSJ Nucleoprotein (Gene Name=N)

[Back to BioLiP]