Structure of PDB 4gfb Chain A Binding Site BS02

Receptor Information
>4gfb Chain A (length=218) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HNKASFTDEEDEFILDVVRKNPTRRTTHTLYDEISHYVPNHTGNSIRHRF
RVYLSKRLEYVYEVDKFGKLVRDDDGNLIKTKVLPPSIKRKFSADEDYTL
AIAVKKQFYRDLFQIDPDTGRSLITVPGSEPNFAAYRTQSRRGPIAREFF
KHFAEEHAAHTENAWRDRFRKFLLAYGIDDYISYYEAEKAQNREPEPMKN
LTNRPRPGVPTPGNYNSA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4gfb Effect of Rap1 binding on DNA distortion and potassium permanganate hypersensitivity.
Resolution2.99 Å
Binding residue
(original residue number in PDB)		N359 K360 T383 T384 H385 T386 R404 S444 I445 K446 K448 P520 I521 A522 R523 R542 R546 K547 R580 R583 P589 G590
Binding residue
(residue number reindexed from 1)		N2 K3 T26 T27 H28 T29 R47 S87 I88 K89 K91 P144 I145 A146 R147 R166 R170 K171 R204 R206 P212 G213
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0000723 telomere maintenance

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4gfb, PDBe:4gfb, PDBj:4gfb
PDBsum4gfb
PubMed23519416
UniProtP11938|RAP1_YEAST DNA-binding protein RAP1 (Gene Name=RAP1)

[Back to BioLiP]