Structure of PDB 4g82 Chain A Binding Site BS02

Receptor Information
>4g82 Chain A (length=201) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HEFIPSNTDYPGPHHFEVTFQQSSTAKSATWTYSPLLKKLYCQIAKTCPI
QIKVSTPPPPGTAIRAMPVYKKAEHVTDVVKRCPNHELGRDFNEGQSAPA
SHLIRVEGNNLSQYVDDPVTGRQSVVVPYEPPQVGTEFTTILYNFMCNSS
CVGGMNRRPILIIITLEMRDGQVLGRRSFEGRICACPGRDRKADEDHYRE
Q
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4g82 Crystal Structure of p73 DNA-Binding Domain Tetramer bound to a Full Response-Element
Resolution3.1 Å
Binding residue
(original residue number in PDB)		S261 R293 C295 A296 R300
Binding residue
(residue number reindexed from 1)		S150 R182 C184 A185 R189
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000976 transcription cis-regulatory region binding
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0006915 apoptotic process
Cellular Component
GO:0005634 nucleus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4g82, PDBe:4g82, PDBj:4g82
PDBsum4g82
PubMed
UniProtO15350|P73_HUMAN Tumor protein p73 (Gene Name=TP73)

[Back to BioLiP]