Structure of PDB 4fzy Chain A Binding Site BS02

Receptor Information

>4fzy Chain A (length=167) Species: 83333 (Escherichia coli K-12) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

MLRIIDTETCGLQGGIVEIASVDVIDGKIVNPMSHLVRPDRPISPQAMAI
HRITEAMVADKPWIEDVIPHYYGSEWYVAHNASFDRRVLPEMPGEWICTM
KLARRLWPGIKYSNMALYKTRKLNVQTPPGLHHHRALYDCYITAALLIDI
MNTSGWTAEQMADITGR

Ligand information

>4fzy Chain D (length=12) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

ctcgaatctaca

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4fzy Recognition and processing of double-stranded DNA by ExoX, a distributive 3'-5' exonuclease
Resolution	2.5 Å
Binding residue (original residue number in PDB)	L12 Q13
Binding residue (residue number reindexed from 1)	L12 Q13

Enzymatic activity

Enzyme Commision number

3.1.11.-

Gene Ontology

	Molecular Function
GO:0003676	nucleic acid binding

View graph for
Molecular Function

External links

PDB	RCSB:4fzy, PDBe:4fzy, PDBj:4fzy
PDBsum	4fzy
PubMed	23771145
UniProt	P0AEK0\|EXOX_ECOLI Exodeoxyribonuclease 10 (Gene Name=exoX)

[Back to BioLiP]