Structure of PDB 4fx4 Chain A Binding Site BS02

Receptor Information
>4fx4 Chain A (length=128) Species: 1773 (Mycobacterium tuberculosis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ECACYTTRRAARQLGQAYDRALRPSGLTNTQFSTLAVISLSEGSDLTMSE
LAARIGVERTTLTRNLEVMRRDGLVRVMAGCKRIELTAKGRAALQKAVPL
WRGVQAEVTAWPRVRRDIANLGQAAEAC
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4fx4 The Oxidation-sensing Regulator (MosR) Is a New Redox-dependent Transcription Factor in Mycobacterium tuberculosis.
Resolution3.1001 Å
Binding residue
(original residue number in PDB)		T38 T72 N76
Binding residue
(residue number reindexed from 1)		T30 T61 N65
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0006950 response to stress
Cellular Component
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4fx4, PDBe:4fx4, PDBj:4fx4
PDBsum4fx4
PubMed22992749
UniProtO53397

[Back to BioLiP]