Structure of PDB 4ftg Chain A Binding Site BS02

Receptor Information
>4ftg Chain A (length=91) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLENQKDPLA
VDKIMKDLDQCRDGKVGFQSFFSLIAGLTIACNDYFVVHMK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4ftg Structure of a C-terminal AHNAK peptide in a 1:2:2 complex with S100A10 and an acetylated N-terminal peptide of annexin A2.
Resolution2.5054 Å
Binding residue
(original residue number in PDB)		G40 N44 Q45 I54 A81 C82 Y85 M90
Binding residue
(residue number reindexed from 1)		G40 N44 Q45 I54 A81 C82 Y85 M90
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005509 calcium ion binding
GO:0005515 protein binding
GO:0008289 lipid binding
GO:0042803 protein homodimerization activity
GO:0044325 transmembrane transporter binding
GO:0048306 calcium-dependent protein binding
Biological Process
GO:0001765 membrane raft assembly
GO:0006900 vesicle budding from membrane
GO:0010756 positive regulation of plasminogen activation
GO:0042789 mRNA transcription by RNA polymerase II
GO:0043547 positive regulation of GTPase activity
GO:0045921 positive regulation of exocytosis
GO:0045944 positive regulation of transcription by RNA polymerase II
GO:0050767 regulation of neurogenesis
GO:0051496 positive regulation of stress fiber assembly
GO:0051894 positive regulation of focal adhesion assembly
GO:0072659 protein localization to plasma membrane
GO:1900026 positive regulation of substrate adhesion-dependent cell spreading
GO:1905686 positive regulation of plasma membrane repair
Cellular Component
GO:0005576 extracellular region
GO:0005615 extracellular space
GO:0005737 cytoplasm
GO:0005886 plasma membrane
GO:0009986 cell surface
GO:0016363 nuclear matrix
GO:0045121 membrane raft
GO:0062023 collagen-containing extracellular matrix
GO:0070062 extracellular exosome
GO:0090575 RNA polymerase II transcription regulator complex
GO:0098797 plasma membrane protein complex
GO:1990665 AnxA2-p11 complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4ftg, PDBe:4ftg, PDBj:4ftg
PDBsum4ftg
PubMed23275167
UniProtP60903|S10AA_HUMAN Protein S100-A10 (Gene Name=S100A10)

[Back to BioLiP]