Structure of PDB 4fb3 Chain A Binding Site BS02

Receptor Information
>4fb3 Chain A (length=115) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SDFPSSLTGYLSHAIYSNKTFPAFLVYSTKEKCKQLYDTIGKFRPEFKCL
VHYEEGGMLFFLTMTKHRVSAVKNYCSKLCSVSFLMCKAVTKPMECYQVV
TAAPFQLITENKPGL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4fb3 Polyomavirus large T antigen binds symmetrical repeats at the viral origin in an asymmetrical manner.
Resolution3.79 Å
Binding residue
(original residue number in PDB)		S301 H302 A303 I304 Y305 S306 N307 K308
Binding residue
(residue number reindexed from 1)		S12 H13 A14 I15 Y16 S17 N18 K19
Binding affinityPDBbind-CN: Kd=38nM
Enzymatic activity
Enzyme Commision number 3.6.4.-
Gene Ontology
Molecular Function
GO:0003688 DNA replication origin binding
Biological Process
GO:0006260 DNA replication

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4fb3, PDBe:4fb3, PDBj:4fb3
PDBsum4fb3
PubMed24109229
UniProtP0DOJ4|LT_POVBG Large T antigen

[Back to BioLiP]