Structure of PDB 4f6n Chain A Binding Site BS02

Receptor Information
>4f6n Chain A (length=120) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DDHYELIVDGRVYYICIVCKRSYVCLTSLRRHFNIHSWEKKYPCRYCEKV
FPLAEYRTKHEIHHTGERRYQCLACGKSFINYQFMSSHIKSVHSQDPSGD
SKLYRLHPCRSLQIRQYAYL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4f6n Molecular basis for recognition of methylated and specific DNA sequences by the zinc finger protein Kaiso.
Resolution2.8 Å
Binding residue
(original residue number in PDB)		R511 K520 E535 T538 R549 Y550 Y562 S578 Y584 L586 R595 Y597
Binding residue
(residue number reindexed from 1)		R31 K40 E55 T58 R69 Y70 Y82 S98 Y104 L106 R115 Y117
Binding affinityPDBbind-CN: Kd=190pM
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:4f6n, PDBe:4f6n, PDBj:4f6n
PDBsum4f6n
PubMed22949637
UniProtQ86T24|KAISO_HUMAN Transcriptional regulator Kaiso (Gene Name=ZBTB33)

[Back to BioLiP]