Structure of PDB 4f02 Chain A Binding Site BS02

Receptor Information
>4f02 Chain A (length=175) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MASLYVGDLHPDVTEAMLYEKFSPAGPILSIRVCRDMITRRSLGYAYVNF
QQPADAERALDTMNFDVIKGKPVRIMWSQRDPSLRKSGVGNIFIKNLDKS
IDNKALYDTFSAFGNILSCKVVCDENGSKGYGFVHFETQEAAERAIEKMN
GMLLNDRKVFVGRFKSRKEREAELG
Ligand information
>4f02 Chain C (length=20) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
TIRIRDPNQGGKDITEEIMS
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4f02 Interdomain Allostery Promotes Assembly of the Poly(A) mRNA Complex with PABP and eIF4G.
Resolution2.0 Å
Binding residue
(original residue number in PDB)		A114 T118 G160 M161 L162 L163 N164 D165
Binding residue
(residue number reindexed from 1)		A105 T109 G151 M152 L153 L154 N155 D156
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding

View graph for
Molecular Function
External links
PDB RCSB:4f02, PDBe:4f02, PDBj:4f02
PDBsum4f02
PubMed23041282
UniProtP11940|PABP1_HUMAN Polyadenylate-binding protein 1 (Gene Name=PABPC1)

[Back to BioLiP]