Structure of PDB 4ezv Chain A Binding Site BS02

Receptor Information

>4ezv Chain A (length=219) Species: 83333 (Escherichia coli K-12) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

VLLLDVTPLSLGIETMGGVMTTLIAKNTTIPTKHSQVFSTAEDNQSAVTI
HVLQGERKRAADNKSLGQFNLDGINPAPRGMPQIEVTFDIDADGILHVSA
KDKNSGKEQKITIKASSGLNEDEIQKMVRDAEANAEADRKFEELVQTRNQ
GDHLLHSTRKQVEEAGDKLPADDKTAIESALTALETALKGEDKAAIEAKM
QELAQVSQKLMEIAQQQHA

Ligand information

>4ezv Chain D (length=10) Species: 161274 (Bombina maxima) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

PPQWAVGHFM

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4ezv Structural studies of DnaK in complex with proline rich antimicrobial peptides reveal two different peptide binding modes
Resolution	2.1 Å
Binding residue (original residue number in PDB)	Q538 H541
Binding residue (residue number reindexed from 1)	Q150 H153

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0005524	ATP binding
GO:0140662	ATP-dependent protein folding chaperone

View graph for
Molecular Function

External links

PDB	RCSB:4ezv, PDBe:4ezv, PDBj:4ezv
PDBsum	4ezv
PubMed
UniProt	P0A6Y8\|DNAK_ECOLI Chaperone protein DnaK (Gene Name=dnaK)

[Back to BioLiP]