Structure of PDB 4ezo Chain A Binding Site BS02

Receptor Information

>4ezo Chain A (length=211) Species: 83333 (Escherichia coli K-12) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

VLLLDVTPLSLGIETMGGVMTTLIAKNTTIPTKHSQVFSTAEDNQSAVTI
HVLQGERKRAADNKSLGQFNLDGINPAPRGMPQIEVTFDIDADGILHVSA
KDKNSGKEQKITIKASSGLNEDEIQKMVRDAEANAEADRKFEELVQTRNQ
GDHLLHSTRKQVEEAGDKLPADDKTAIESALTALETALKGEDKAAIEAKM
QELAQVSQKLM

Ligand information

>4ezo Chain D (length=8) Species: 9823 (Sus scrofa) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

PPYLPRPR

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4ezo Structural Studies on the Forward and Reverse Binding Modes of Peptides to the Chaperone DnaK.
Resolution	1.9 Å
Binding residue (original residue number in PDB)	D518 A521
Binding residue (residue number reindexed from 1)	D130 A133

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0005524	ATP binding
GO:0140662	ATP-dependent protein folding chaperone

View graph for
Molecular Function

External links

PDB	RCSB:4ezo, PDBe:4ezo, PDBj:4ezo
PDBsum	4ezo
PubMed	23562829
UniProt	P0A6Y8\|DNAK_ECOLI Chaperone protein DnaK (Gene Name=dnaK)

[Back to BioLiP]