Structure of PDB 4exh Chain A Binding Site BS02

Receptor Information
>4exh Chain A (length=114) Species: 114654 (DG-75 Murine leukemia virus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EPPPEPRITLKVGGQPVTFLVDTGAQHSVLTQNPGPLSDKSAWVQGATGG
KRYRWTTDRKVHLATGKVTHSFLHVPDCPYPLLGRDLLTKLKAQIHFEGS
GAQVVGPMGQPLQV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4exh Inhibition of XMRV and HIV-1 proteases by pepstatin A and acetyl-pepstatin.
Resolution2.0 Å
Binding residue
(original residue number in PDB)		D32 G34 Q36 V54 Q55 G56 A57
Binding residue
(residue number reindexed from 1)		D22 G24 Q26 V44 Q45 G46 A47
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0004190 aspartic-type endopeptidase activity
Biological Process
GO:0006508 proteolysis

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4exh, PDBe:4exh, PDBj:4exh
PDBsum4exh
PubMed22804908
UniProtQ9E7M1

[Back to BioLiP]