Structure of PDB 4ew4 Chain A Binding Site BS02

Receptor Information
>4ew4 Chain A (length=142) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KWTPPRSPFNLVQEILFHDPWKLLIATIFLNRTSGKMAIPVLWEFLEKYP
SAEVARAADWRDVSELLKPLGLYDLRAKTIIKFSDEYLTKQWRYPIELHG
IGKYGNDSYRIFCVNEWKQVHPEDHKLNKYHDWLWENHEKLS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4ew4 Excision of thymine and 5-hydroxymethyluracil by the MBD4 DNA glycosylase domain: structural basis and implications for active DNA demethylation.
Resolution2.791 Å
Binding residue
(original residue number in PDB)		L440 N441 R442 T443 S444 H509 G510 I511 G512 Y514 D534 K536
Binding residue
(residue number reindexed from 1)		L30 N31 R32 T33 S34 H99 G100 I101 G102 Y104 D124 K126
Enzymatic activity
Enzyme Commision number 3.2.2.-
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003824 catalytic activity
Biological Process
GO:0006281 DNA repair
GO:0006284 base-excision repair

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4ew4, PDBe:4ew4, PDBj:4ew4
PDBsum4ew4
PubMed22740654
UniProtQ9Z2D7|MBD4_MOUSE Methyl-CpG-binding domain protein 4 (Gene Name=Mbd4)

[Back to BioLiP]