Structure of PDB 4evv Chain A Binding Site BS02

Receptor Information
>4evv Chain A (length=145) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MKWTPPRSPFNLVQEILFHDPWKLLIATIFLNRTSGKMAIPVLWEFLEKY
PSAEVARAADWRDVSELLKPLGLYDLRAKTIIKFSDEYLTKQWRYPIELH
GIGKYGNDSYRIFCVNEWKQVHPENHKLNKYHDWLWENHEKLSLS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4evv Excision of thymine and 5-hydroxymethyluracil by the MBD4 DNA glycosylase domain: structural basis and implications for active DNA demethylation.
Resolution2.39 Å
Binding residue
(original residue number in PDB)		L421 Q423 L440 N441 R442 S444 G445 H509 G510 G512 Y514 G515 N534 K536
Binding residue
(residue number reindexed from 1)		L12 Q14 L31 N32 R33 S35 G36 H100 G101 G103 Y105 G106 N125 K127
Enzymatic activity
Enzyme Commision number 3.2.2.-
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003824 catalytic activity
Biological Process
GO:0006281 DNA repair
GO:0006284 base-excision repair

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4evv, PDBe:4evv, PDBj:4evv
PDBsum4evv
PubMed22740654
UniProtQ9Z2D7|MBD4_MOUSE Methyl-CpG-binding domain protein 4 (Gene Name=Mbd4)

[Back to BioLiP]