Structure of PDB 4euw Chain A Binding Site BS02

Receptor Information
>4euw Chain A (length=72) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PHVKRPMNAFMVWAQAARRKLADQYPHLHNAELSKTLGKLWRLLNESEKR
PFVEEAERLRVQHKKDHPDYKY
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4euw Crystal structure of a HMG domain of transcription factor SOX-9 bound to DNA (SOX-9/DNA) from Homo sapiens at 2.77 A resolution
Resolution2.77 Å
Binding residue
(original residue number in PDB)		H104 K106 R107 M109 M113 R120 H131 N132
Binding residue
(residue number reindexed from 1)		H2 K4 R5 M7 M11 R18 H29 N30
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:4euw, PDBe:4euw, PDBj:4euw
PDBsum4euw
PubMed
UniProtP48436|SOX9_HUMAN Transcription factor SOX-9 (Gene Name=SOX9)

[Back to BioLiP]