Structure of PDB 4ets Chain A Binding Site BS02

Receptor Information

>4ets Chain A (length=141) Species: 32022 (Campylobacter jejuni subsp. jejuni)

ENVEYDVLLERFKKILRQGGLKYTKQREVLLKTLYHSDTHYTPESLYMEI
KQAEPDLNVGIATVYRTLNLLEEAEMVTSISKKYELANKPHHDHMICKNC
GKIIEFENPIIERQQALIAKEHGFKLTGHLMQLYGVCGDCN

Ligand information

• Ligand ID: ZN
• InChI: InChI=1S/Zn/q+2
• InChIKey: PTFCDOFLOPIGGS-UHFFFAOYSA-N
• SMILES:
  CACTVS 3.341: [Zn++]
  ACDLabs 10.04
  OpenEye OEToolkits 1.5.0: [Zn+2]
• Formula: Zn
• Name: ZINC ION
• ChEMBL: CHEMBL1236970
• DrugBank: DB14532
• PDB chain: 4ets Chain A Residue 302

Receptor-Ligand Complex Structure

Structure summary

• PDB: 4ets Structure and regulon of Campylobacter jejuni ferric uptake regulator Fur define apo-Fur regulation.
• Resolution: 2.1 Å
• Binding residue (original residue number in PDB): C205 C208 C245 C248
• Binding residue (residue number reindexed from 1): C97 C100 C137 C140
• Annotation score: 4

Gene Ontology

Molecular Function

• GO:0000976 transcription cis-regulatory region binding
• GO:0003677 DNA binding
• GO:0003700 DNA-binding transcription factor activity
• GO:0008270 zinc ion binding
• GO:0042802 identical protein binding
• GO:0046872 metal ion binding

Biological Process

• GO:0006355 regulation of DNA-templated transcription
• GO:0045892 negative regulation of DNA-templated transcription
• GO:1900705 negative regulation of siderophore biosynthetic process

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol

External links

• PDB: RCSB:4ets, PDBe:4ets, PDBj:4ets
• PDBsum: 4ets
• PubMed: 22665794
• UniProt: P0C631|FUR_CAMJE Ferric uptake regulation protein (Gene Name=fur)