Structure of PDB 4erd Chain A Binding Site BS02

Receptor Information
>4erd Chain A (length=108) Species: 5911 (Tetrahymena thermophila) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NCLIKIINIPQGTLKAEVVLAVRHLGYEFYCDYIDGQAMIRFQNSDEQRL
AIQKLLNHNNNKLQIEIRGQICDVISTIPEDEEKNYWNYIKFKKNEFRKF
FFMKKQQK
Ligand information
>4erd Chain D (length=22) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ggucgacaucuucggauggacc
......................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4erd Structural Basis for Telomerase RNA Recognition and RNP Assembly by the Holoenzyme La Family Protein p65.
Resolution2.589 Å
Binding residue
(original residue number in PDB)		F406 Y407 D409 R465 Q467 I514 K517 K518 F521 R522
Binding residue
(residue number reindexed from 1)		F29 Y30 D32 R41 Q43 I90 K93 K94 F97 R98
Binding affinityPDBbind-CN: Kd=101nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:4erd, PDBe:4erd, PDBj:4erd
PDBsum4erd
PubMed22705372
UniProtW7X6T2|LARP7_TETTS La-related protein 7 homolog (Gene Name=TAP65)

[Back to BioLiP]