Structure of PDB 4e9f Chain A Binding Site BS02

Receptor Information
>4e9f Chain A (length=138) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KWTPPRSPFNLVQETLFHDPWKLLIATIFLNRTSGKMAIPVLWKFLEKYP
SAEVARTADWRDVSELLKPLGLYDLRAKTIVKFSDEYLTKQWKYPIELHG
IGKYGNDSYRIFCVNEWKQVHPEDHKLNKYHDWLWENH
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4e9f Biochemical and structural characterization of the glycosylase domain of MBD4 bound to thymine and 5-hydroxymethyuracil-containing DNA.
Resolution1.79 Å
Binding residue
(original residue number in PDB)		R468 K472 M473 K504 P505 L506 G507 L508 Y509 D510 L511
Binding residue
(residue number reindexed from 1)		R32 K36 M37 K68 P69 L70 G71 L72 Y73 D74 L75
Enzymatic activity
Enzyme Commision number 3.2.2.-
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003824 catalytic activity
Biological Process
GO:0006281 DNA repair
GO:0006284 base-excision repair

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4e9f, PDBe:4e9f, PDBj:4e9f
PDBsum4e9f
PubMed22848106
UniProtO95243|MBD4_HUMAN Methyl-CpG-binding domain protein 4 (Gene Name=MBD4)

[Back to BioLiP]