Structure of PDB 4e0j Chain A Binding Site BS02

Receptor Information
>4e0j Chain A (length=319) Species: 176299 (Agrobacterium fabrum str. C58) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
YPKTGVATSIVEKIERAEFNTAGRKPTVLLRIADFIAAMNGMDAKQDMQA
LWDAEIAIMNGRAQTTIISYITKYRNAIREAFGDDHPMLKIATGDAAMYD
EARRVKMEKIANKHGALITFENYRQVLKICEDCLKSSDPLMIGIGLIGMT
GRAPYEVFTQAEFSPAPYGKGVSKWSILFNGQAKTKQGEGTKFGITYEIP
VLTRSETVLAAYKRLRESGQGKLWHGMSIDDFSSETRLLLRDTVFNLFED
VWPKEELPKPYGLRHLYAEVAYHNFAPPHVTKNSYFAAILGHNNNDLETS
LSYMTYTLPEDRDNALARL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4e0j An enzyme-catalyzed multistep DNA refolding mechanism in hairpin telomere formation.
Resolution2.3 Å
Binding residue
(original residue number in PDB)		T123 A124 G125 R126 K127 T174 R177 R181 T195 Y201 R205 K208 P256 Y257 K286 T287 K288 T293 I331 R339 R343 K361 P362 Y363 H394 N395
Binding residue
(residue number reindexed from 1)		T21 A22 G23 R24 K25 T72 R75 R79 T93 Y99 R103 K106 P154 Y155 K184 T185 K186 T191 I229 R237 R241 K259 P260 Y261 H292 N293
Enzymatic activity
Enzyme Commision number ?
External links