Structure of PDB 4dow Chain A Binding Site BS02

Receptor Information

>4dow Chain A (length=157) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

TFSWVGRPLPNRKQFQQMYREICMKINDGSEIHIKVGQFVLIQGEDNKKP
YVAKLIELFQNGAEVPPKKCARVQWFVRFLEIPVSKRHLLGRSPPAQEIF
WYDCSDWDNKINVETIIGPVQVVALAPEEVIPVDQKSEETLFVKLSWNKK
DFAPLPP

Ligand information

>4dow Chain D (length=10) Species: 10090 (Mus musculus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

GAKRHRKVLR

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4dow The BAH domain of ORC1 links H4K20me2 to DNA replication licensing and Meier-Gorlin syndrome.
Resolution	1.95 Å
Binding residue (original residue number in PDB)	P22 R32
Binding residue (residue number reindexed from 1)	P10 R20

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003682	chromatin binding

View graph for
Molecular Function

External links

PDB	RCSB:4dow, PDBe:4dow, PDBj:4dow
PDBsum	4dow
PubMed	22398447
UniProt	Q9Z1N2\|ORC1_MOUSE Origin recognition complex subunit 1 (Gene Name=Orc1)

[Back to BioLiP]