Structure of PDB 4dk9 Chain A Binding Site BS02

Receptor Information
>4dk9 Chain A (length=140) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
WTPPRSPFNLVQETLFHDPWKLLIATIFLNRTSGKMAIPVLWKFLEKYPS
AEVARTADWRDVSELLKPLGLYDLRAKTIVKFSDEYLTKQWKYPIELHGI
GKYGNDSYRIFCVNEWKQVHPEDHKLNKYHDWLWENHEKL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4dk9 Crystal Structure of Human Methyl-Binding Domain IV Glycosylase Bound to Abasic DNA.
Resolution2.76 Å
Binding residue
(original residue number in PDB)		L466 N467 R468 S470 G536 G538 K539 Y540
Binding residue
(residue number reindexed from 1)		L29 N30 R31 S33 G99 G101 K102 Y103
Enzymatic activity
Enzyme Commision number 3.2.2.-
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003824 catalytic activity
Biological Process
GO:0006281 DNA repair
GO:0006284 base-excision repair

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4dk9, PDBe:4dk9, PDBj:4dk9
PDBsum4dk9
PubMed22560993
UniProtO95243|MBD4_HUMAN Methyl-CpG-binding domain protein 4 (Gene Name=MBD4)

[Back to BioLiP]