Structure of PDB 4cyc Chain A Binding Site BS02

Receptor Information
>4cyc Chain A (length=66) Species: 7227 (Drosophila melanogaster) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FYPWMARQTYTRYQTLELEKEFHTNHYLTRRRRIEMAHALCLTERQIKIW
FQNRRMKLKKEIQAIK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4cyc A Flexible Extension of the Drosophila Ultrabithorax Homeodomain Defines a Novel Hox/Pbc Interaction Mode.
Resolution2.36 Å
Binding residue
(original residue number in PDB)		R5 Q6 T7 Y8 Q44 I47 N51 K55
Binding residue
(residue number reindexed from 1)		R7 Q8 T9 Y10 Q46 I49 N53 K57
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription
Cellular Component
GO:0005634 nucleus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4cyc, PDBe:4cyc, PDBj:4cyc
PDBsum4cyc
PubMed25651060
UniProtP83949|UBX_DROME Homeotic protein ultrabithorax (Gene Name=Ubx)

[Back to BioLiP]