Structure of PDB 4cn5 Chain A Binding Site BS02

Receptor Information
>4cn5 Chain A (length=81) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MFTKHICAICGDRSSGKHYGVYSCEGCKGFFKRTVRKDLTYTCRDNKDCL
IDKRQRNRCQYCRYQKCLAMGMKREAVQEER
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4cn5 Structural Basis of Natural Promoter Recognition by the Retinoid X Nuclear Receptor.
Resolution2.0 Å
Binding residue
(original residue number in PDB)
E153 G154 R161 R184 N185 Q188 R191
Binding residue
(residue number reindexed from 1)
E25 G26 R33 R56 N57 Q60 R63
Binding affinityPDBbind-CN: Kd=40nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0008270 zinc ion binding
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process
External links
PDB RCSB:4cn5, PDBe:4cn5, PDBj:4cn5
PDBsum4cn5
PubMed25645674
UniProtP19793|RXRA_HUMAN Retinoic acid receptor RXR-alpha (Gene Name=RXRA)

[Back to BioLiP]