Structure of PDB 4bu0 Chain A Binding Site BS02

Receptor Information
>4bu0 Chain A (length=182) Species: 4896 (Schizosaccharomyces pombe) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SKPLKGFVICCTSIDLKQRTEISTKATKLGAAYRSDFTKDVTHLIAGDFD
TPKYKFAAKSRPDIKIMSSEWIPVLYESWVQGEDLDDGLLVDKHLLPTLF
KCRVCLTNIGQPERSRIENYVLKHGGTFCPDLTRDVTHLIAGTSSGRKYE
YALKWKINVVCVEWLWQSIQRNAVLEPQYFQL
Ligand information
>4bu0 Chain C (length=16) Species: 4896 (Schizosaccharomyces pombe) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GYGEVLVPETVAQHRT
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4bu0 Phosphorylation-Dependent Assembly and Coordination of the DNA Damage Checkpoint Apparatus by Rad4(Topbp1.).
Resolution1.5 Å
Binding residue
(original residue number in PDB)		T110 G113 Q114 E116 R117 P133 D134 L135 T136 R137 R150 K151 Y154
Binding residue
(residue number reindexed from 1)		T107 G110 Q111 E113 R114 P130 D131 L132 T133 R134 R147 K148 Y151
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:4bu0, PDBe:4bu0, PDBj:4bu0
PDBsum4bu0
PubMed24074952
UniProtP32372|RAD4_SCHPO S-M checkpoint control protein rad4 (Gene Name=rad4)

[Back to BioLiP]