Structure of PDB 4bqd Chain A Binding Site BS02

Receptor Information
>4bqd Chain A (length=78) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SEEDEEHTIITDTELPPLKLMHSFCAFKADDGPCKAIMKRFFFNIFTRQC
EEFIYGGCEGNQNRFESLEECKKMCTRD
Ligand information
>4bqd Chain D (length=20) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
FQSKPNVHVDGYFERLAAKL
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4bqd Small Peptides Blocking Inhibition of Factor Xa and Tissue Factor-Factor Viia by Tissue Factor Pathway Inhibitor (Tfpi)
Resolution2.48 Å
Binding residue
(original residue number in PDB)		M39 R41
Binding residue
(residue number reindexed from 1)		M38 R40
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0004867 serine-type endopeptidase inhibitor activity

View graph for
Molecular Function
External links
PDB RCSB:4bqd, PDBe:4bqd, PDBj:4bqd
PDBsum4bqd
PubMed24275667
UniProtP10646|TFPI1_HUMAN Tissue factor pathway inhibitor (Gene Name=TFPI)

[Back to BioLiP]