Structure of PDB 4bnc Chain A Binding Site BS02

Receptor Information

>4bnc Chain A (length=95) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

SLQLWQFLVALLDDPSNSHFIAWTGRGMEFKLIEPEEVARRWGIQKNRPA
MNYDKLSRSLRYYYEKGIMQKVAGERYVYKFVCDPEALFSMAFSD

Ligand information

>4bnc Chain C (length=10) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

cacttccggt

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4bnc Structures of the Ets Domains of Transcription Factors Etv1, Etv4, Etv5 and Fev: Determinants of DNA Binding and Redox Regulation by Disulfide Bond Formation.
Resolution	2.9 Å
Binding residue (original residue number in PDB)	Q336 W375 K379 M384 K388 R391 S392 Y395 Y396 D428
Binding residue (residue number reindexed from 1)	Q3 W42 K46 M51 K55 R58 S59 Y62 Y63 D95

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003700	DNA-binding transcription factor activity
GO:0043565	sequence-specific DNA binding

	Biological Process
GO:0006355	regulation of DNA-templated transcription
GO:0006357	regulation of transcription by RNA polymerase II

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:4bnc, PDBe:4bnc, PDBj:4bnc
PDBsum	4bnc
PubMed	25866208
UniProt	P50549\|ETV1_HUMAN ETS translocation variant 1 (Gene Name=ETV1)

[Back to BioLiP]