Structure of PDB 4bj3 Chain A Binding Site BS02

Receptor Information
>4bj3 Chain A (length=183) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LIDVVVVCDESNSIYPWDAVKNFLEKFVQGLDIGPTKTQVGLIQYANNPR
VVFNLNTYKTKEEMIVATSQTSQYGGDLTNTFGAIQYARKYAYSAASGGR
RSATKVMVVVTDGESHDGSMLKAVIDQCNHDNILRFGIAVLGYLNRNALD
TKNLIKEIKAIASIPTERYFFNVSDWAALLEKA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4bj3 An Activating Mutation Reveals a Second Binding Mode of the Integrin Alpha2 I Domain to the Gfoger Motif in Collagens.
Resolution3.042 Å
Binding residue
(original residue number in PDB)
S153 N154 S155 Q215 D219 L220 T221 H258
Binding residue
(residue number reindexed from 1)
S11 N12 S13 Q73 D77 L78 T79 H116
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:4bj3, PDBe:4bj3, PDBj:4bj3
PDBsum4bj3
PubMed23922814
UniProtP17301|ITA2_HUMAN Integrin alpha-2 (Gene Name=ITGA2)

[Back to BioLiP]