Structure of PDB 4b22 Chain A Binding Site BS02

Receptor Information
>4b22 Chain A (length=205) Species: 4896 (Schizosaccharomyces pombe) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DSDYKRAEKHLSSIDNKWSSLVKKVGPCTLTPHPEHAPYEGIIRAITSQK
LSDAATNSIINKFCTQCSDNDEFPTPKQIMETDVETLHECGFSKLKSQEI
HIVAEAALNKQIPSKSEIEKMSEEELMESLSKIKGVKRWTIEMYSIFTLG
RLDIMPADDSTLKNEAKEFFGLSSKPQTEEVEKLTKPCKPYRTIAAWYLW
QIPKL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4b22 Sculpting of DNA at Abasic Sites by DNA Glycosylase Homolog Mag2.
Resolution1.9 Å
Binding residue
(original residue number in PDB)		K53 L54 S55 A58 S61 G94 S96 K97 K99
Binding residue
(residue number reindexed from 1)		K50 L51 S52 A55 S58 G91 S93 K94 K96
Enzymatic activity
Enzyme Commision number 3.2.2.21: DNA-3-methyladenine glycosylase II.
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003824 catalytic activity
GO:0003905 alkylbase DNA N-glycosylase activity
GO:0032131 alkylated DNA binding
GO:0140431 DNA-(abasic site) binding
Biological Process
GO:0000725 recombinational repair
GO:0006281 DNA repair
GO:0006284 base-excision repair
GO:0006285 base-excision repair, AP site formation
GO:0006289 nucleotide-excision repair
GO:0006307 DNA alkylation repair
Cellular Component
GO:0005634 nucleus
GO:0032993 protein-DNA complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4b22, PDBe:4b22, PDBj:4b22
PDBsum4b22
PubMed23245849
UniProtO94468|MAG2_SCHPO Alkylbase DNA glycosidase-like protein mag2 (Gene Name=mag2)

[Back to BioLiP]