Structure of PDB 4auv Chain A Binding Site BS02

Receptor Information

>4auv Chain A (length=35) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

SEDYERRRSECVSEMLDLEKQFSELKEKLFRERLS

Ligand information

>4auv Chain D (length=18) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

SECVSEMLDLEKQFSELK

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4auv Brms151-98 and Brms151-84 are Crystal Oligomeric Coiled Coils with Different Oligomerization States, which Behave as Disordered Protein Fragments in Solution.
Resolution	1.999 Å
Binding residue (original residue number in PDB)	E59 C60 E63 M64 L67 Q70 F71 L74
Binding residue (residue number reindexed from 1)	E10 C11 E14 M15 L18 Q21 F22 L25

Enzymatic activity

Enzyme Commision number

External links

PDB	RCSB:4auv, PDBe:4auv, PDBj:4auv
PDBsum	4auv
PubMed	23500495
UniProt	Q9HCU9\|BRMS1_HUMAN Breast cancer metastasis-suppressor 1 (Gene Name=BRMS1)

[Back to BioLiP]