Structure of PDB 4ati Chain A Binding Site BS02

Receptor Information
>4ati Chain A (length=57) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HNLIERRRRFNINDRIKELGTLIPKSMRWNKGTILKASVDYIRKLQREQQ
RAKDLEN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4ati Restricted Leucine Zipper Dimerization and Specificity of DNA Recognition of the Melanocyte Master Regulator Mitf
Resolution2.6 Å
Binding residue
(original residue number in PDB)		H209 I212 E213 R216
Binding residue
(residue number reindexed from 1)		H1 I4 E5 R8
Binding affinityPDBbind-CN: Kd=2.5nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0046983 protein dimerization activity

View graph for
Molecular Function
External links
PDB RCSB:4ati, PDBe:4ati, PDBj:4ati
PDBsum4ati
PubMed23207919
UniProtQ08874|MITF_MOUSE Microphthalmia-associated transcription factor (Gene Name=Mitf)

[Back to BioLiP]