Structure of PDB 3zp5 Chain A Binding Site BS02

Receptor Information
>3zp5 Chain A (length=92) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SGQIQLWQFLLELLADRANAGCIAWEGGHGEFKLTDPDEVARRWGERKSK
PNMNYDKLSRALRYYYDKNIMSKVHGKRYAYRFDFQGLAQAC
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3zp5 Structures of the Ets Domains of Transcription Factors Etv1, Etv4, Etv5 and Fev: Determinants of DNA Binding and Redox Regulation by Disulfide Bond Formation.
Resolution2.0 Å
Binding residue
(original residue number in PDB)		Y98 R103 R106 Y109 K116 R121 Y122
Binding residue
(residue number reindexed from 1)		Y55 R60 R63 Y66 K73 R78 Y79
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0006357 regulation of transcription by RNA polymerase II

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:3zp5, PDBe:3zp5, PDBj:3zp5
PDBsum3zp5
PubMed25866208
UniProtQ99581|FEV_HUMAN Protein FEV (Gene Name=FEV)

[Back to BioLiP]