Structure of PDB 3zi5 Chain A Binding Site BS02

Receptor Information
>3zi5 Chain A (length=166) Species: 1399 (Cytobacillus firmus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LDETERVTLIVTLGHADTARIQAAPGTTAGQGTQYFWLSKDSYDFFPPLT
IRNRRGTKATYSSLINMNYIDINYTDTQCRVTFEAENNFDFRLGTGKLRY
TGVAKSNDIAAITRVGDSDYELRIIKQGTPEHSQLDPYAVSFIGNRGKRF
GYISNEEFGRIIGVTF
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3zi5 Structural Insight Into the Specificity of the B3 DNA-Binding Domains Provided by the Co-Crystal Structure of the C-Terminal Fragment of Bfii Restriction Enzyme
Resolution3.2 Å
Binding residue
(original residue number in PDB)		H207 A208 R212 Q223 G224 W229 S231 K232 N280 D282 I335 G336 R338 K340
Binding residue
(residue number reindexed from 1)		H15 A16 R20 Q31 G32 W37 S39 K40 N88 D90 I143 G144 R146 K148
Binding affinityPDBbind-CN: Kd=2nM
Enzymatic activity
Enzyme Commision number 3.1.21.4: type II site-specific deoxyribonuclease.
External links