Structure of PDB 3wtx Chain A Binding Site BS02

Receptor Information
>3wtx Chain A (length=118) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GELVRTDSPNFLCSVLPTHWRCNKTLPIAFKVVAKGDVPDGTLVTVMAGN
DENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQV
ATYHRAIKITVDGPREPR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3wtx A novel allosteric mechanism on protein-DNA interactions underlying the phosphorylation-dependent regulation of Ets1 target gene expressions.
Resolution2.8 Å
Binding residue
(original residue number in PDB)		R80 R135 R142 R174 R177
Binding residue
(residue number reindexed from 1)		R21 R76 R83 R115 R118
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0005524 ATP binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
Cellular Component
GO:0005634 nucleus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3wtx, PDBe:3wtx, PDBj:3wtx
PDBsum3wtx
PubMed25083921
UniProtQ03347|RUNX1_MOUSE Runt-related transcription factor 1 (Gene Name=Runx1)

[Back to BioLiP]