Structure of PDB 3vea Chain A Binding Site BS02

Receptor Information

>3vea Chain A (length=149) Species: 632 (Yersinia pestis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

MKYQQLENLESGWKWAYLVKKHREGEAITRHIENSAAQDAVEQLMKLENE
PVKVQEWIDAHMNVNLATRMKQTIRARRKRHFNAEHQHTRKKSIDLEFLV
WQRLAVLARRRGNTLSDTVVQLIEDAERKEKYASQMSSLKQDLKDILDK

Ligand information

>3vea Chain M (length=23) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

agttcgtgacaatgtcacgaact

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	3vea Molecular basis for a protein-mediated DNA-bridging mechanism that functions in condensation of the E. coli chromosome.
Resolution	2.55 Å
Binding residue (original residue number in PDB)	M14 K15 Y16 R88 R91 K92 W114 T127 L128
Binding residue (residue number reindexed from 1)	M1 K2 Y3 R75 R78 K79 W101 T114 L115

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0043565	sequence-specific DNA binding

	Biological Process
GO:0006355	regulation of DNA-templated transcription
GO:0051301	cell division

	Cellular Component
GO:0005737	cytoplasm

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:3vea, PDBe:3vea, PDBj:3vea
PDBsum	3vea
PubMed	23084832
UniProt	Q8ZG78\|MATP_YERPE Macrodomain Ter protein (Gene Name=matP)

[Back to BioLiP]