Structure of PDB 3va3 Chain A Binding Site BS02

Receptor Information

>3va3 Chain A (length=205) Species: 83333 (Escherichia coli K-12)

QLTGLCDRFRGFYPVVIDVETAGFNAKTDALLEIAAITLKMDEQGWLMPD
TTLHFHVEPFVGANLQPEALAFNGIDPNDPDRGAVSGYEALHEIFKVVRK
GIKASGCNRAIMVAHNANFDHSFMMAAAERASLKRNPFHPFATFDTAALA
GLALGQTVLSKACQTAGMDFDSTQAHSALYDTERTAVLFCEIVNRWKRLG
GWPLS

Ligand information

>3va3 Chain D (length=4)

cctt

Receptor-Ligand Complex Structure

Structure summary

• PDB: 3va3 How an exonuclease decides where to stop in trimming of nucleic acids: crystal structures of RNase T-product complexes
• Resolution: 2.714 Å
• Binding residue (original residue number in PDB): R15 H144 F146
• Binding residue (residue number reindexed from 1): R10 H139 F141

Enzymatic activity

• Enzyme Commision number: 3.1.13.-

Gene Ontology

Molecular Function

• GO:0000175 3'-5'-RNA exonuclease activity
• GO:0000287 magnesium ion binding
• GO:0003676 nucleic acid binding
• GO:0004527 exonuclease activity
• GO:0004540 RNA nuclease activity
• GO:0005515 protein binding
• GO:0008310 single-stranded DNA 3'-5' DNA exonuclease activity
• GO:0008408 3'-5' exonuclease activity
• GO:0016896 RNA exonuclease activity, producing 5'-phosphomonoesters
• GO:0042802 identical protein binding
• GO:0042803 protein homodimerization activity
• GO:0046872 metal ion binding

Biological Process

• GO:0006259 DNA metabolic process
• GO:0006396 RNA processing
• GO:0006974 DNA damage response
• GO:0008033 tRNA processing
• GO:0031125 rRNA 3'-end processing
• GO:0034644 cellular response to UV
• GO:0042780 tRNA 3'-end processing
• GO:0043628 regulatory ncRNA 3'-end processing
• GO:0045004 DNA replication proofreading

Cellular Component

• GO:0005829 cytosol

External links

• PDB: RCSB:3va3, PDBe:3va3, PDBj:3va3
• PDBsum: 3va3
• PubMed: 22718982
• UniProt: P30014|RNT_ECOLI Ribonuclease T (Gene Name=rnt)