Structure of PDB 3ukg Chain A Binding Site BS02

Receptor Information
>3ukg Chain A (length=223) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KASFTDEEDEFILDVVRKNPTRRTTHTLYDEISHYVPNHTGNSIRHRFRV
YLSKRLEYVYEVDKFGKLVRDDDGNLIKTKVLPPSIKRKFSADEDYTLAI
AVKKQFYRDLFQIDPDTGRSPNHVPGSEPNFAAYRTQSRRGPIAREFFKH
FAEEHAAHTENAWRDRFRKFLLAYGIDDYISYYEAEKAQNREPEPMKNLT
NRPKRPGVPTPGNYNSAAKRARN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3ukg The orientation of the C-terminal domain of the Saccharomyces cerevisiae Rap1 protein is determined by its binding to DNA.
Resolution2.95 Å
Binding residue
(original residue number in PDB)		K360 T383 T384 H385 T386 R404 R408 S444 I445 K446 K448 R518 P520 I521 A522 R523 R542 R546 K547 R580 P589 G590
Binding residue
(residue number reindexed from 1)		K1 T24 T25 H26 T27 R45 R49 S85 I86 K87 K89 R140 P142 I143 A144 R145 R164 R168 K169 R202 P211 G212
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0000723 telomere maintenance

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:3ukg, PDBe:3ukg, PDBj:3ukg
PDBsum3ukg
PubMed22139930
UniProtP11938|RAP1_YEAST DNA-binding protein RAP1 (Gene Name=RAP1)

[Back to BioLiP]