Structure of PDB 3uby Chain A Binding Site BS02

Receptor Information

>3uby Chain A (length=204) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

GPHMTRLGLEFFDQPAVPLARAFLGQVLVRRLPNGTELRGRIVETEAYLG
PEDEAAHSRGGRQTPRNRGMFMKPGTLYVYIIYGMYFCMNISSQGDGACV
LLRALEPLEGLETMRQLRSTLLKDRELCSGPSKLCQALAINKSFDQRDLA
QDEAVWLERGPLEPSEPAVVAAARVGVAGEWARKPLRFYVRGSPWVSVVD
RVAE

Ligand information

>3uby Chain D (length=8) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

gacatgct

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	3uby Searching for DNA lesions: structural evidence for lower- and higher-affinity DNA binding conformations of human alkyladenine DNA glycosylase.
Resolution	2.0 Å
Binding residue (original residue number in PDB)	R141 T143 P144 R145 Y162 G163
Binding residue (residue number reindexed from 1)	R62 T64 P65 R66 Y83 G84
Binding affinity	PDBbind-CN: Kd=21nM

Enzymatic activity

Enzyme Commision number

3.2.2.21: DNA-3-methyladenine glycosylase II.

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0003824	catalytic activity
GO:0003905	alkylbase DNA N-glycosylase activity

	Biological Process
GO:0006284	base-excision repair

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:3uby, PDBe:3uby, PDBj:3uby
PDBsum	3uby
PubMed	22148158
UniProt	P29372\|3MG_HUMAN DNA-3-methyladenine glycosylase (Gene Name=MPG)

[Back to BioLiP]