Structure of PDB 3ts0 Chain A Binding Site BS02

Receptor Information
>3ts0 Chain A (length=136) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PQLLHGAGICKWFNVRMGFGFLSMTARAGVALDPPVDVFVHQSKLHMEGF
RSLKEGEAVEFTFKKSAKGLESIRVTGPGGVFCIGSERRPKGGDRCYNCG
GLDHHAKECKLPPQPKKCHFCQSINHMVASCPLKAQ
Ligand information
>3ts0 Chain V (length=23) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gggguagugauuuuacccuggag
<<<<<<.......>>>>>>....
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3ts0 Molecular Basis for Interaction of let-7 MicroRNAs with Lin28.
Resolution2.763 Å
Binding residue
(original residue number in PDB)		G136 R138 C139 Y140 H148 A149 Q157 K159 K160 C161 H162 F163 M170 V171 K177
Binding residue
(residue number reindexed from 1)		G93 R95 C96 Y97 H105 A106 Q114 K116 K117 C118 H119 F120 M127 V128 K134
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0008270 zinc ion binding

View graph for
Molecular Function
External links
PDB RCSB:3ts0, PDBe:3ts0, PDBj:3ts0
PDBsum3ts0
PubMed22078496
UniProtQ8K3Y3|LN28A_MOUSE Protein lin-28 homolog A (Gene Name=Lin28a)

[Back to BioLiP]