Structure of PDB 3trz Chain A Binding Site BS02

Receptor Information
>3trz Chain A (length=130) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PQLLHGAGICKWFNVRMGFGFLSMTARAGVALDPPVDVFVHQSKLHMEGF
RSLKEGEAVEFTFKKSAKGLESIRVTGPGGVFCIGSEDRCYNCGGLDHHA
KECKLPPQPKKCHFCQSINHMVASCPLKAQ
Ligand information
>3trz Chain V (length=21) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gggcagggauuuugcccggag
<<<<<.......>>>>>....
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3trz Molecular Basis for Interaction of let-7 MicroRNAs with Lin28.
Resolution2.9 Å
Binding residue
(original residue number in PDB)		R138 Y140 H148 A149 K150 Q157 K159 K160 C161 H162 M170 V171 K177
Binding residue
(residue number reindexed from 1)		R89 Y91 H99 A100 K101 Q108 K110 K111 C112 H113 M121 V122 K128
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0008270 zinc ion binding

View graph for
Molecular Function
External links
PDB RCSB:3trz, PDBe:3trz, PDBj:3trz
PDBsum3trz
PubMed22078496
UniProtQ8K3Y3|LN28A_MOUSE Protein lin-28 homolog A (Gene Name=Lin28a)

[Back to BioLiP]