Structure of PDB 3tkz Chain A Binding Site BS02

Receptor Information
>3tkz Chain A (length=100) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RRWFHPNITGVEAENLLLTRGVDGSFLARPSKSNPGDFTLSVRRNGAVTH
IKIQNTGDYYDLYGGEKFATLAELVQYYMEHHGQLKEKNGDVIELKYPLN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3tkz Simultaneous binding of two peptidyl ligands by a SRC homology 2 domain.
Resolution1.8 Å
Binding residue
(original residue number in PDB)
G67 Q87 L88 K89 E90 K91
Binding residue
(residue number reindexed from 1)
G64 Q84 L85 K86 E87 K88
Enzymatic activity
Enzyme Commision number 3.1.3.48: protein-tyrosine-phosphatase.
External links
PDB RCSB:3tkz, PDBe:3tkz, PDBj:3tkz
PDBsum3tkz
PubMed21800896
UniProtQ06124|PTN11_HUMAN Tyrosine-protein phosphatase non-receptor type 11 (Gene Name=PTPN11)

[Back to BioLiP]