Structure of PDB 3szq Chain A Binding Site BS02

Receptor Information

>3szq Chain A (length=199) Species: 284812 (Schizosaccharomyces pombe 972h-) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

QSFRDNLKVYIESPESYKNVIYYDDDVVLVRDMFPKSKMHLLLMTRDPHL
THVHPLEIMMKHRSLVEKLVSYVQGDLSGLIFDEARNCLSQQLTNEALCN
YIKVGFHAGPSMNNLHLHIMTLDHVSPSLKNSAHYISFTSPFFVKIDTPT
SNLPTRGTLTSLFQEDLKCWRCGETFGRHFTKLKAHLQEEYDDWLDKSV

Ligand information

>3szq Chain C (length=8) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

aatcaggg

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	3szq Structure of an aprataxin-DNA complex with insights into AOA1 neurodegenerative disease.
Resolution	2.353 Å
Binding residue (original residue number in PDB)	F34 R209 F211 T212
Binding residue (residue number reindexed from 1)	F3 R178 F180 T181
Binding affinity	PDBbind-CN: Kd=190nM

Enzymatic activity

Enzyme Commision number

3.6.1.71: adenosine-5'-diphospho-5'-[DNA] diphosphatase.
3.6.1.72: DNA-3'-diphospho-5'-guanosine diphosphatase.

Gene Ontology

	Molecular Function
GO:0003824	catalytic activity

View graph for
Molecular Function

External links

PDB	RCSB:3szq, PDBe:3szq, PDBj:3szq
PDBsum	3szq
PubMed	21984210
UniProt	O74859\|APTX_SCHPO Aprataxin-like protein (Gene Name=hnt3)

[Back to BioLiP]