Structure of PDB 3stj Chain A Binding Site BS02

Receptor Information

>3stj Chain A (length=300) Species: 83333 (Escherichia coli K-12) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

PLPSLAPMLEKVLPAVVSVRVEGTQPFEGLGSGVIINASKGYVLTNNHVI
NQAQKISIQLNDGREFDAKLIGSDDQSDIALLQIQNPSKLTQIAIADSDK
LRVGDFAVAVGNPFGLGQTATSGIVSALGRSGLNLEGLENFIQTDASINR
GNSGGALLNLNGELIGINTAILAPGGGSVGIGFAIPSNMARTLAQQLIDF
GEIKRGLLGIKGTEMSADIAKAFNLDVQRGAFVSEVLPGSGSAKAGVKAG
DIITSLNGKPLNSFAELRSRIATTEPGTKVKLGLLRNGKPLEVEVTLDTS

Ligand information

>3stj Chain Z (length=7) Species: 562 (Escherichia coli) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

AAAAAAA

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	3stj Molecular adaptation of the DegQ protease to exert protein quality control in the bacterial cell envelope.
Resolution	2.6 Å
Binding residue (original residue number in PDB)	N183 R184 S187 T203 A204 I205 P208
Binding residue (residue number reindexed from 1)	N149 R150 S153 T169 A170 I171 P174

Enzymatic activity

Enzyme Commision number

3.4.21.107: peptidase Do.

Gene Ontology

	Molecular Function
GO:0004252	serine-type endopeptidase activity

	Biological Process
GO:0006508	proteolysis

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:3stj, PDBe:3stj, PDBj:3stj
PDBsum	3stj
PubMed	21685389
UniProt	P39099\|DEGQ_ECOLI Periplasmic pH-dependent serine endoprotease DegQ (Gene Name=degQ)

[Back to BioLiP]