Structure of PDB 3ssc Chain A Binding Site BS02

Receptor Information
>3ssc Chain A (length=154) Species: 83333 (Escherichia coli K-12) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ESIQPWIEKFIKQAQQQRSQSTKDYPTSYRNLRVKLSFGYGNFTSIPWFA
FLGEGQEASNGIYPVILYYKDFDELVLAYGISDTNEPHAQWQFSSDIPKT
IAEYFQATSGVYPKKYGQSYYACSQKVSQGIDYTRFASMLDNIINDYKLI
FNSG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3ssc The recognition domain of the methyl-specific endonuclease McrBC flips out 5-methylcytosine.
Resolution2.1 Å
Binding residue
(original residue number in PDB)
S38 G40 Y41 G42 N43 T45 W49 A59 S60 Y64 I82 S83 D84 T85 K116 Y117
Binding residue
(residue number reindexed from 1)
S37 G39 Y40 G41 N42 T44 W48 A58 S59 Y63 I81 S82 D83 T84 K115 Y116
Enzymatic activity
Enzyme Commision number 3.1.21.-
External links
PDB RCSB:3ssc, PDBe:3ssc, PDBj:3ssc
PDBsum3ssc
PubMed22570415
UniProtP15005|MCRB_ECOLI Type IV methyl-directed restriction enzyme EcoKMcrB subunit (Gene Name=mcrB)

[Back to BioLiP]