Structure of PDB 3rzh Chain A Binding Site BS02

Receptor Information

>3rzh Chain A (length=201) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

HSWRHIRAEGLDSSYTVLFGKAEADEIFQELEKEVEYFTGALARVQVFGK
WHSVPRKQATYGDAGLTYTFSGLTLSPKPWIPVLERIRDHVSGVTGQTFN
FVLINRYKDGSDHICEHRDDERELAPGSPIASVSFGASRDFVFRHKDSRP
SRRVAVVRLPLAHGSLLMMNHPTNTHWYHSLPVRKKVLAPRVNLTFRKIL
L

Ligand information

>3rzh Chain C (length=13) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

tcgcagtgagaca

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	3rzh Duplex interrogation by a direct DNA repair protein in search of base damage
Resolution	2.25 Å
Binding residue (original residue number in PDB)	F102 G103 R198 R241 K243
Binding residue (residue number reindexed from 1)	F48 G49 R144 R184 K186

Enzymatic activity

Enzyme Commision number

1.14.11.33: DNA oxidative demethylase.

Gene Ontology

	Biological Process
GO:0006281	DNA repair

View graph for
Biological Process

External links

PDB	RCSB:3rzh, PDBe:3rzh, PDBj:3rzh
PDBsum	3rzh
PubMed	22659876
UniProt	Q6NS38\|ALKB2_HUMAN DNA oxidative demethylase ALKBH2 (Gene Name=ALKBH2)

[Back to BioLiP]