Structure of PDB 3rn5 Chain A Binding Site BS02

Receptor Information

>3rn5 Chain A (length=194) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

EGFQKRCLPVMVLKAKKPFTFETQEGKQEMFHATVATEKEFFFVKVFNTL
LKDKFIPKRIIIIARYYRHSGFLEVNSASRVLDAESDQKVNVPLNIIRKA
GETPKINTLQTQPLGTIVNGLFVVQKVTEKKKNILFDLSDNTGKMEVLGV
RNEDTMKCKEGDKVRLTFFTLSKNGEKLQLTSGVHSTIKVIKAK

Ligand information

>3rn5 Chain L (length=19) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

gctctttctctctttgatg

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	3rn5 Structures of the HIN Domain:DNA Complexes Reveal Ligand Binding and Activation Mechanisms of the AIM2 Inflammasome and IFI16 Receptor.
Resolution	2.5 Å
Binding residue (original residue number in PDB)	K204 E248 T249
Binding residue (residue number reindexed from 1)	K58 E102 T103

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Biological Process
GO:0002218	activation of innate immune response
GO:0035458	cellular response to interferon-beta

View graph for
Biological Process

External links

PDB	RCSB:3rn5, PDBe:3rn5, PDBj:3rn5
PDBsum	3rn5
PubMed	22483801
UniProt	O14862\|AIM2_HUMAN Interferon-inducible protein AIM2 (Gene Name=AIM2)

[Back to BioLiP]