Structure of PDB 3rmp Chain A Binding Site BS02

Receptor Information
>3rmp Chain A (length=77) Species: 632 (Yersinia pestis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SLTDAKIRTLKPSDKPFKVSDSHGLYLLVKPGGSRHWYLKYRISGKESRI
ALGAYPAISLSDARQQREGIRKMLALN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3rmp Structural basis for the recognition of attP substrates by P4-like integrases
Resolution2.21 Å
Binding residue
(original residue number in PDB)		K19 S21 S23 H24 G25 K41 R43
Binding residue
(residue number reindexed from 1)		K18 S20 S22 H23 G24 K40 R42
Enzymatic activity
Enzyme Commision number ?
External links