Structure of PDB 3rkq Chain A Binding Site BS02

Receptor Information
>3rkq Chain A (length=58) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GRRKPRVLFSQAQVYELERRFKQQRYLSAPERDQLASVLKLTSTQVKIWF
QNRRYKSK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3rkq Crystal structure of the human NKX2.5 homeodomain in complex with DNA target.
Resolution1.7 Å
Binding residue
(original residue number in PDB)		Y162 R168 K183 Q187 R190 Y191
Binding residue
(residue number reindexed from 1)		Y26 R32 K47 Q51 R54 Y55
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003677 DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:3rkq, PDBe:3rkq, PDBj:3rkq
PDBsum3rkq
PubMed22849347
UniProtP52952|NKX25_HUMAN Homeobox protein Nkx-2.5 (Gene Name=NKX2-5)

[Back to BioLiP]