Structure of PDB 3ri4 Chain A Binding Site BS02

Receptor Information
>3ri4 Chain A (length=136) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GTFKDYVRDRADLNKDKPVIPAAALAGYTGSGPIQLWQFLLELLTDKSCQ
SFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNI
IHKTAGKRYVYRFVCDLQSLLGYTPEELHAMLDVKP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3ri4 Structural basis of ets1 cooperative binding to widely separated sites on promoter DNA.
Resolution3.0 Å
Binding residue
(original residue number in PDB)
P334 Y386 R391 R394 Y397 K404 R409 Y410
Binding residue
(residue number reindexed from 1)
P33 Y85 R90 R93 Y96 K103 R108 Y109
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0006357 regulation of transcription by RNA polymerase II

View graph for
Molecular Function

View graph for
Biological Process
External links
PDB RCSB:3ri4, PDBe:3ri4, PDBj:3ri4
PDBsum3ri4
PubMed22432043
UniProtP14921|ETS1_HUMAN Protein C-ets-1 (Gene Name=ETS1)

[Back to BioLiP]