Structure of PDB 3qrp Chain A Binding Site BS02

Receptor Information
>3qrp Chain A (length=214) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
YFQMWLTKLVLNPASRAARRDLANPYEMHRTLSKAVSRALEEGRERLLWR
LEPARGLEPPVVLVQTLTEPDWSVLDEGYAQVFPPKPFHPALKPGQRLRF
RLRANPAKRLAATGKRVALKTPAEKVAWLERRLEEGGFRLLEGERGPWVQ
ILQDTFLEVRRKKDGEEAGKLLQVQAVLFEGRLEVVDPERALATLRRGVG
PGKALGLGLLSVAP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3qrp Recognition and maturation of effector RNAs in a CRISPR interference pathway.
Resolution2.352 Å
Binding residue
(original residue number in PDB)		R43 K105 R106 A108 R113 R128 R129 R158 L169 K200
Binding residue
(residue number reindexed from 1)		R46 K108 R109 A111 R116 R131 R132 R161 L172 K203
Enzymatic activity
Catalytic site (original residue number in PDB) D68 V171 F176 E177
Catalytic site (residue number reindexed from 1) D71 V174 F179 E180
Enzyme Commision number 3.1.-.-
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0004519 endonuclease activity
Biological Process
GO:0051607 defense response to virus

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:3qrp, PDBe:3qrp, PDBj:3qrp
PDBsum3qrp
PubMed21572444
UniProtQ53WG9|CAS6_THET8 CRISPR-associated endoribonuclease Cse3 (Gene Name=cse3)

[Back to BioLiP]