Structure of PDB 3qoq Chain A Binding Site BS02

Receptor Information
>3qoq Chain A (length=50) Species: 287 (Pseudomonas aeruginosa) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TYSSRTADKFVVRLPEGMREQIAEVARSHHRSMNSEIIARLEQSLLQEGA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3qoq The Transcription Factor AmrZ Utilizes Multiple DNA Binding Modes to Recognize Activator and Repressor Sequences of Pseudomonas aeruginosa Virulence Genes.
Resolution3.1 Å
Binding residue
(original residue number in PDB)		K18 F19
Binding residue
(residue number reindexed from 1)		K9 F10
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:3qoq, PDBe:3qoq, PDBj:3qoq
PDBsum3qoq
PubMed22511872
UniProtG3XCY4|AMRZ_PSEAE Transcription factor AmrZ (Gene Name=amrZ)

[Back to BioLiP]